1. Packages
  2. Packages
  3. Intersight Provider
  4. API Docs
  5. getNiatelemetryApicSnmpTrapFwdServerDetails
Viewing docs for intersight 1.0.78
published on Tuesday, Apr 21, 2026 by ciscodevnet
Viewing docs for intersight 1.0.78
published on Tuesday, Apr 21, 2026 by ciscodevnet

    Object to capture the SNMP Trap Fwd Server details in APIC.

    Using getNiatelemetryApicSnmpTrapFwdServerDetails

    Two invocation forms are available. The direct form accepts plain arguments and either blocks until the result value is available, or returns a Promise-wrapped result. The output form accepts Input-wrapped arguments and returns an Output-wrapped result.

    function getNiatelemetryApicSnmpTrapFwdServerDetails(args: GetNiatelemetryApicSnmpTrapFwdServerDetailsArgs, opts?: InvokeOptions): Promise<GetNiatelemetryApicSnmpTrapFwdServerDetailsResult>
    function getNiatelemetryApicSnmpTrapFwdServerDetailsOutput(args: GetNiatelemetryApicSnmpTrapFwdServerDetailsOutputArgs, opts?: InvokeOptions): Output<GetNiatelemetryApicSnmpTrapFwdServerDetailsResult>
    def get_niatelemetry_apic_snmp_trap_fwd_server_details(account_moid: Optional[str] = None,
                                                           additional_properties: Optional[str] = None,
                                                           address: Optional[str] = None,
                                                           ancestors: Optional[Sequence[GetNiatelemetryApicSnmpTrapFwdServerDetailsAncestor]] = None,
                                                           class_id: Optional[str] = None,
                                                           create_time: Optional[str] = None,
                                                           dn: Optional[str] = None,
                                                           domain_group_moid: Optional[str] = None,
                                                           id: Optional[str] = None,
                                                           mod_time: Optional[str] = None,
                                                           moid: Optional[str] = None,
                                                           object_type: Optional[str] = None,
                                                           owners: Optional[Sequence[str]] = None,
                                                           parent: Optional[GetNiatelemetryApicSnmpTrapFwdServerDetailsParent] = None,
                                                           permission_resources: Optional[Sequence[GetNiatelemetryApicSnmpTrapFwdServerDetailsPermissionResource]] = None,
                                                           pol_dn: Optional[str] = None,
                                                           record_type: Optional[str] = None,
                                                           record_version: Optional[str] = None,
                                                           registered_device: Optional[GetNiatelemetryApicSnmpTrapFwdServerDetailsRegisteredDevice] = None,
                                                           shared_scope: Optional[str] = None,
                                                           site_name: Optional[str] = None,
                                                           tags: Optional[Sequence[GetNiatelemetryApicSnmpTrapFwdServerDetailsTag]] = None,
                                                           version_context: Optional[GetNiatelemetryApicSnmpTrapFwdServerDetailsVersionContext] = None,
                                                           opts: Optional[InvokeOptions] = None) -> GetNiatelemetryApicSnmpTrapFwdServerDetailsResult
    def get_niatelemetry_apic_snmp_trap_fwd_server_details_output(account_moid: pulumi.Input[Optional[str]] = None,
                                                           additional_properties: pulumi.Input[Optional[str]] = None,
                                                           address: pulumi.Input[Optional[str]] = None,
                                                           ancestors: pulumi.Input[Optional[Sequence[pulumi.Input[GetNiatelemetryApicSnmpTrapFwdServerDetailsAncestorArgs]]]] = None,
                                                           class_id: pulumi.Input[Optional[str]] = None,
                                                           create_time: pulumi.Input[Optional[str]] = None,
                                                           dn: pulumi.Input[Optional[str]] = None,
                                                           domain_group_moid: pulumi.Input[Optional[str]] = None,
                                                           id: pulumi.Input[Optional[str]] = None,
                                                           mod_time: pulumi.Input[Optional[str]] = None,
                                                           moid: pulumi.Input[Optional[str]] = None,
                                                           object_type: pulumi.Input[Optional[str]] = None,
                                                           owners: pulumi.Input[Optional[Sequence[pulumi.Input[str]]]] = None,
                                                           parent: pulumi.Input[Optional[GetNiatelemetryApicSnmpTrapFwdServerDetailsParentArgs]] = None,
                                                           permission_resources: pulumi.Input[Optional[Sequence[pulumi.Input[GetNiatelemetryApicSnmpTrapFwdServerDetailsPermissionResourceArgs]]]] = None,
                                                           pol_dn: pulumi.Input[Optional[str]] = None,
                                                           record_type: pulumi.Input[Optional[str]] = None,
                                                           record_version: pulumi.Input[Optional[str]] = None,
                                                           registered_device: pulumi.Input[Optional[GetNiatelemetryApicSnmpTrapFwdServerDetailsRegisteredDeviceArgs]] = None,
                                                           shared_scope: pulumi.Input[Optional[str]] = None,
                                                           site_name: pulumi.Input[Optional[str]] = None,
                                                           tags: pulumi.Input[Optional[Sequence[pulumi.Input[GetNiatelemetryApicSnmpTrapFwdServerDetailsTagArgs]]]] = None,
                                                           version_context: pulumi.Input[Optional[GetNiatelemetryApicSnmpTrapFwdServerDetailsVersionContextArgs]] = None,
                                                           opts: Optional[InvokeOptions] = None) -> Output[GetNiatelemetryApicSnmpTrapFwdServerDetailsResult]
    func LookupNiatelemetryApicSnmpTrapFwdServerDetails(ctx *Context, args *LookupNiatelemetryApicSnmpTrapFwdServerDetailsArgs, opts ...InvokeOption) (*LookupNiatelemetryApicSnmpTrapFwdServerDetailsResult, error)
    func LookupNiatelemetryApicSnmpTrapFwdServerDetailsOutput(ctx *Context, args *LookupNiatelemetryApicSnmpTrapFwdServerDetailsOutputArgs, opts ...InvokeOption) LookupNiatelemetryApicSnmpTrapFwdServerDetailsResultOutput

    > Note: This function is named LookupNiatelemetryApicSnmpTrapFwdServerDetails in the Go SDK.

    public static class GetNiatelemetryApicSnmpTrapFwdServerDetails 
    {
        public static Task<GetNiatelemetryApicSnmpTrapFwdServerDetailsResult> InvokeAsync(GetNiatelemetryApicSnmpTrapFwdServerDetailsArgs args, InvokeOptions? opts = null)
        public static Output<GetNiatelemetryApicSnmpTrapFwdServerDetailsResult> Invoke(GetNiatelemetryApicSnmpTrapFwdServerDetailsInvokeArgs args, InvokeOptions? opts = null)
    }
    public static CompletableFuture<GetNiatelemetryApicSnmpTrapFwdServerDetailsResult> getNiatelemetryApicSnmpTrapFwdServerDetails(GetNiatelemetryApicSnmpTrapFwdServerDetailsArgs args, InvokeOptions options)
    public static Output<GetNiatelemetryApicSnmpTrapFwdServerDetailsResult> getNiatelemetryApicSnmpTrapFwdServerDetails(GetNiatelemetryApicSnmpTrapFwdServerDetailsArgs args, InvokeOptions options)
    
    fn::invoke:
      function: intersight:index/getNiatelemetryApicSnmpTrapFwdServerDetails:getNiatelemetryApicSnmpTrapFwdServerDetails
      arguments:
        # arguments dictionary
    data "intersight_getniatelemetryapicsnmptrapfwdserverdetails" "name" {
        # arguments
    }

    The following arguments are supported:

    AccountMoid string
    The Account ID for this managed object.
    AdditionalProperties string
    Address string
    Address of SNMP Trap Fwd Server in APIC.
    Ancestors List<GetNiatelemetryApicSnmpTrapFwdServerDetailsAncestor>
    ClassId string
    CreateTime string
    The time when this managed object was created.
    Dn string
    Dn of the SNMP Trap Fwd Server details in APIC.
    DomainGroupMoid string
    The DomainGroup ID for this managed object.
    Id string
    ModTime string
    The time when this managed object was last modified.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Owners List<string>
    Parent GetNiatelemetryApicSnmpTrapFwdServerDetailsParent
    PermissionResources List<GetNiatelemetryApicSnmpTrapFwdServerDetailsPermissionResource>
    PolDn string
    Dn of the parent SNMP Policy in APIC.
    RecordType string
    Type of record DCNM / APIC / SE. This determines the type of platform where inventory was collected.
    RecordVersion string
    Version of record being pushed. This determines what was the API version for data available from the device.
    RegisteredDevice GetNiatelemetryApicSnmpTrapFwdServerDetailsRegisteredDevice
    SharedScope string
    Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
    SiteName string
    Name of the APIC site from which this data is being collected.
    Tags List<GetNiatelemetryApicSnmpTrapFwdServerDetailsTag>
    VersionContext GetNiatelemetryApicSnmpTrapFwdServerDetailsVersionContext
    AccountMoid string
    The Account ID for this managed object.
    AdditionalProperties string
    Address string
    Address of SNMP Trap Fwd Server in APIC.
    Ancestors []GetNiatelemetryApicSnmpTrapFwdServerDetailsAncestor
    ClassId string
    CreateTime string
    The time when this managed object was created.
    Dn string
    Dn of the SNMP Trap Fwd Server details in APIC.
    DomainGroupMoid string
    The DomainGroup ID for this managed object.
    Id string
    ModTime string
    The time when this managed object was last modified.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Owners []string
    Parent GetNiatelemetryApicSnmpTrapFwdServerDetailsParent
    PermissionResources []GetNiatelemetryApicSnmpTrapFwdServerDetailsPermissionResource
    PolDn string
    Dn of the parent SNMP Policy in APIC.
    RecordType string
    Type of record DCNM / APIC / SE. This determines the type of platform where inventory was collected.
    RecordVersion string
    Version of record being pushed. This determines what was the API version for data available from the device.
    RegisteredDevice GetNiatelemetryApicSnmpTrapFwdServerDetailsRegisteredDevice
    SharedScope string
    Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
    SiteName string
    Name of the APIC site from which this data is being collected.
    Tags []GetNiatelemetryApicSnmpTrapFwdServerDetailsTag
    VersionContext GetNiatelemetryApicSnmpTrapFwdServerDetailsVersionContext
    account_moid string
    The Account ID for this managed object.
    additional_properties string
    address string
    Address of SNMP Trap Fwd Server in APIC.
    ancestors list(object)
    class_id string
    create_time string
    The time when this managed object was created.
    dn string
    Dn of the SNMP Trap Fwd Server details in APIC.
    domain_group_moid string
    The DomainGroup ID for this managed object.
    id string
    mod_time string
    The time when this managed object was last modified.
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    owners list(string)
    parent object
    permission_resources list(object)
    pol_dn string
    Dn of the parent SNMP Policy in APIC.
    record_type string
    Type of record DCNM / APIC / SE. This determines the type of platform where inventory was collected.
    record_version string
    Version of record being pushed. This determines what was the API version for data available from the device.
    registered_device object
    shared_scope string
    Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
    site_name string
    Name of the APIC site from which this data is being collected.
    tags list(object)
    version_context object
    accountMoid String
    The Account ID for this managed object.
    additionalProperties String
    address String
    Address of SNMP Trap Fwd Server in APIC.
    ancestors List<GetNiatelemetryApicSnmpTrapFwdServerDetailsAncestor>
    classId String
    createTime String
    The time when this managed object was created.
    dn String
    Dn of the SNMP Trap Fwd Server details in APIC.
    domainGroupMoid String
    The DomainGroup ID for this managed object.
    id String
    modTime String
    The time when this managed object was last modified.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    owners List<String>
    parent GetNiatelemetryApicSnmpTrapFwdServerDetailsParent
    permissionResources List<GetNiatelemetryApicSnmpTrapFwdServerDetailsPermissionResource>
    polDn String
    Dn of the parent SNMP Policy in APIC.
    recordType String
    Type of record DCNM / APIC / SE. This determines the type of platform where inventory was collected.
    recordVersion String
    Version of record being pushed. This determines what was the API version for data available from the device.
    registeredDevice GetNiatelemetryApicSnmpTrapFwdServerDetailsRegisteredDevice
    sharedScope String
    Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
    siteName String
    Name of the APIC site from which this data is being collected.
    tags List<GetNiatelemetryApicSnmpTrapFwdServerDetailsTag>
    versionContext GetNiatelemetryApicSnmpTrapFwdServerDetailsVersionContext
    accountMoid string
    The Account ID for this managed object.
    additionalProperties string
    address string
    Address of SNMP Trap Fwd Server in APIC.
    ancestors GetNiatelemetryApicSnmpTrapFwdServerDetailsAncestor[]
    classId string
    createTime string
    The time when this managed object was created.
    dn string
    Dn of the SNMP Trap Fwd Server details in APIC.
    domainGroupMoid string
    The DomainGroup ID for this managed object.
    id string
    modTime string
    The time when this managed object was last modified.
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    owners string[]
    parent GetNiatelemetryApicSnmpTrapFwdServerDetailsParent
    permissionResources GetNiatelemetryApicSnmpTrapFwdServerDetailsPermissionResource[]
    polDn string
    Dn of the parent SNMP Policy in APIC.
    recordType string
    Type of record DCNM / APIC / SE. This determines the type of platform where inventory was collected.
    recordVersion string
    Version of record being pushed. This determines what was the API version for data available from the device.
    registeredDevice GetNiatelemetryApicSnmpTrapFwdServerDetailsRegisteredDevice
    sharedScope string
    Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
    siteName string
    Name of the APIC site from which this data is being collected.
    tags GetNiatelemetryApicSnmpTrapFwdServerDetailsTag[]
    versionContext GetNiatelemetryApicSnmpTrapFwdServerDetailsVersionContext
    account_moid str
    The Account ID for this managed object.
    additional_properties str
    address str
    Address of SNMP Trap Fwd Server in APIC.
    ancestors Sequence[GetNiatelemetryApicSnmpTrapFwdServerDetailsAncestor]
    class_id str
    create_time str
    The time when this managed object was created.
    dn str
    Dn of the SNMP Trap Fwd Server details in APIC.
    domain_group_moid str
    The DomainGroup ID for this managed object.
    id str
    mod_time str
    The time when this managed object was last modified.
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    owners Sequence[str]
    parent GetNiatelemetryApicSnmpTrapFwdServerDetailsParent
    permission_resources Sequence[GetNiatelemetryApicSnmpTrapFwdServerDetailsPermissionResource]
    pol_dn str
    Dn of the parent SNMP Policy in APIC.
    record_type str
    Type of record DCNM / APIC / SE. This determines the type of platform where inventory was collected.
    record_version str
    Version of record being pushed. This determines what was the API version for data available from the device.
    registered_device GetNiatelemetryApicSnmpTrapFwdServerDetailsRegisteredDevice
    shared_scope str
    Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
    site_name str
    Name of the APIC site from which this data is being collected.
    tags Sequence[GetNiatelemetryApicSnmpTrapFwdServerDetailsTag]
    version_context GetNiatelemetryApicSnmpTrapFwdServerDetailsVersionContext
    accountMoid String
    The Account ID for this managed object.
    additionalProperties String
    address String
    Address of SNMP Trap Fwd Server in APIC.
    ancestors List<Property Map>
    classId String
    createTime String
    The time when this managed object was created.
    dn String
    Dn of the SNMP Trap Fwd Server details in APIC.
    domainGroupMoid String
    The DomainGroup ID for this managed object.
    id String
    modTime String
    The time when this managed object was last modified.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    owners List<String>
    parent Property Map
    permissionResources List<Property Map>
    polDn String
    Dn of the parent SNMP Policy in APIC.
    recordType String
    Type of record DCNM / APIC / SE. This determines the type of platform where inventory was collected.
    recordVersion String
    Version of record being pushed. This determines what was the API version for data available from the device.
    registeredDevice Property Map
    sharedScope String
    Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
    siteName String
    Name of the APIC site from which this data is being collected.
    tags List<Property Map>
    versionContext Property Map

    getNiatelemetryApicSnmpTrapFwdServerDetails Result

    The following output properties are available:

    Supporting Types

    GetNiatelemetryApicSnmpTrapFwdServerDetailsAncestor

    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties string
    class_id string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties string
    classId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties str
    class_id str
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    The fully-qualified name of the remote type referred by this relationship.
    selector str
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.

    GetNiatelemetryApicSnmpTrapFwdServerDetailsParent

    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties string
    class_id string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties string
    classId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties str
    class_id str
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    The fully-qualified name of the remote type referred by this relationship.
    selector str
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.

    GetNiatelemetryApicSnmpTrapFwdServerDetailsPermissionResource

    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties string
    class_id string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties string
    classId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties str
    class_id str
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    The fully-qualified name of the remote type referred by this relationship.
    selector str
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.

    GetNiatelemetryApicSnmpTrapFwdServerDetailsRegisteredDevice

    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties string
    class_id string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties string
    classId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties str
    class_id str
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    The fully-qualified name of the remote type referred by this relationship.
    selector str
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.

    GetNiatelemetryApicSnmpTrapFwdServerDetailsResult

    AccountMoid string
    The Account ID for this managed object.
    AdditionalProperties string
    Address string
    Address of SNMP Trap Fwd Server in APIC.
    Ancestors List<GetNiatelemetryApicSnmpTrapFwdServerDetailsResultAncestor>
    ClassId string
    CreateTime string
    The time when this managed object was created.
    Dn string
    Dn of the SNMP Trap Fwd Server details in APIC.
    DomainGroupMoid string
    The DomainGroup ID for this managed object.
    ModTime string
    The time when this managed object was last modified.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Owners List<string>
    Parents List<GetNiatelemetryApicSnmpTrapFwdServerDetailsResultParent>
    PermissionResources List<GetNiatelemetryApicSnmpTrapFwdServerDetailsResultPermissionResource>
    PolDn string
    Dn of the parent SNMP Policy in APIC.
    RecordType string
    Type of record DCNM / APIC / SE. This determines the type of platform where inventory was collected.
    RecordVersion string
    Version of record being pushed. This determines what was the API version for data available from the device.
    RegisteredDevices List<GetNiatelemetryApicSnmpTrapFwdServerDetailsResultRegisteredDevice>
    SharedScope string
    Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
    SiteName string
    Name of the APIC site from which this data is being collected.
    Tags List<GetNiatelemetryApicSnmpTrapFwdServerDetailsResultTag>
    VersionContexts List<GetNiatelemetryApicSnmpTrapFwdServerDetailsResultVersionContext>
    AccountMoid string
    The Account ID for this managed object.
    AdditionalProperties string
    Address string
    Address of SNMP Trap Fwd Server in APIC.
    Ancestors []GetNiatelemetryApicSnmpTrapFwdServerDetailsResultAncestor
    ClassId string
    CreateTime string
    The time when this managed object was created.
    Dn string
    Dn of the SNMP Trap Fwd Server details in APIC.
    DomainGroupMoid string
    The DomainGroup ID for this managed object.
    ModTime string
    The time when this managed object was last modified.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Owners []string
    Parents []GetNiatelemetryApicSnmpTrapFwdServerDetailsResultParent
    PermissionResources []GetNiatelemetryApicSnmpTrapFwdServerDetailsResultPermissionResource
    PolDn string
    Dn of the parent SNMP Policy in APIC.
    RecordType string
    Type of record DCNM / APIC / SE. This determines the type of platform where inventory was collected.
    RecordVersion string
    Version of record being pushed. This determines what was the API version for data available from the device.
    RegisteredDevices []GetNiatelemetryApicSnmpTrapFwdServerDetailsResultRegisteredDevice
    SharedScope string
    Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
    SiteName string
    Name of the APIC site from which this data is being collected.
    Tags []GetNiatelemetryApicSnmpTrapFwdServerDetailsResultTag
    VersionContexts []GetNiatelemetryApicSnmpTrapFwdServerDetailsResultVersionContext
    account_moid string
    The Account ID for this managed object.
    additional_properties string
    address string
    Address of SNMP Trap Fwd Server in APIC.
    ancestors list(object)
    class_id string
    create_time string
    The time when this managed object was created.
    dn string
    Dn of the SNMP Trap Fwd Server details in APIC.
    domain_group_moid string
    The DomainGroup ID for this managed object.
    mod_time string
    The time when this managed object was last modified.
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    owners list(string)
    parents list(object)
    permission_resources list(object)
    pol_dn string
    Dn of the parent SNMP Policy in APIC.
    record_type string
    Type of record DCNM / APIC / SE. This determines the type of platform where inventory was collected.
    record_version string
    Version of record being pushed. This determines what was the API version for data available from the device.
    registered_devices list(object)
    shared_scope string
    Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
    site_name string
    Name of the APIC site from which this data is being collected.
    tags list(object)
    version_contexts list(object)
    accountMoid String
    The Account ID for this managed object.
    additionalProperties String
    address String
    Address of SNMP Trap Fwd Server in APIC.
    ancestors List<GetNiatelemetryApicSnmpTrapFwdServerDetailsResultAncestor>
    classId String
    createTime String
    The time when this managed object was created.
    dn String
    Dn of the SNMP Trap Fwd Server details in APIC.
    domainGroupMoid String
    The DomainGroup ID for this managed object.
    modTime String
    The time when this managed object was last modified.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    owners List<String>
    parents List<GetNiatelemetryApicSnmpTrapFwdServerDetailsResultParent>
    permissionResources List<GetNiatelemetryApicSnmpTrapFwdServerDetailsResultPermissionResource>
    polDn String
    Dn of the parent SNMP Policy in APIC.
    recordType String
    Type of record DCNM / APIC / SE. This determines the type of platform where inventory was collected.
    recordVersion String
    Version of record being pushed. This determines what was the API version for data available from the device.
    registeredDevices List<GetNiatelemetryApicSnmpTrapFwdServerDetailsResultRegisteredDevice>
    sharedScope String
    Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
    siteName String
    Name of the APIC site from which this data is being collected.
    tags List<GetNiatelemetryApicSnmpTrapFwdServerDetailsResultTag>
    versionContexts List<GetNiatelemetryApicSnmpTrapFwdServerDetailsResultVersionContext>
    accountMoid string
    The Account ID for this managed object.
    additionalProperties string
    address string
    Address of SNMP Trap Fwd Server in APIC.
    ancestors GetNiatelemetryApicSnmpTrapFwdServerDetailsResultAncestor[]
    classId string
    createTime string
    The time when this managed object was created.
    dn string
    Dn of the SNMP Trap Fwd Server details in APIC.
    domainGroupMoid string
    The DomainGroup ID for this managed object.
    modTime string
    The time when this managed object was last modified.
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    owners string[]
    parents GetNiatelemetryApicSnmpTrapFwdServerDetailsResultParent[]
    permissionResources GetNiatelemetryApicSnmpTrapFwdServerDetailsResultPermissionResource[]
    polDn string
    Dn of the parent SNMP Policy in APIC.
    recordType string
    Type of record DCNM / APIC / SE. This determines the type of platform where inventory was collected.
    recordVersion string
    Version of record being pushed. This determines what was the API version for data available from the device.
    registeredDevices GetNiatelemetryApicSnmpTrapFwdServerDetailsResultRegisteredDevice[]
    sharedScope string
    Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
    siteName string
    Name of the APIC site from which this data is being collected.
    tags GetNiatelemetryApicSnmpTrapFwdServerDetailsResultTag[]
    versionContexts GetNiatelemetryApicSnmpTrapFwdServerDetailsResultVersionContext[]
    account_moid str
    The Account ID for this managed object.
    additional_properties str
    address str
    Address of SNMP Trap Fwd Server in APIC.
    ancestors Sequence[GetNiatelemetryApicSnmpTrapFwdServerDetailsResultAncestor]
    class_id str
    create_time str
    The time when this managed object was created.
    dn str
    Dn of the SNMP Trap Fwd Server details in APIC.
    domain_group_moid str
    The DomainGroup ID for this managed object.
    mod_time str
    The time when this managed object was last modified.
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    owners Sequence[str]
    parents Sequence[GetNiatelemetryApicSnmpTrapFwdServerDetailsResultParent]
    permission_resources Sequence[GetNiatelemetryApicSnmpTrapFwdServerDetailsResultPermissionResource]
    pol_dn str
    Dn of the parent SNMP Policy in APIC.
    record_type str
    Type of record DCNM / APIC / SE. This determines the type of platform where inventory was collected.
    record_version str
    Version of record being pushed. This determines what was the API version for data available from the device.
    registered_devices Sequence[GetNiatelemetryApicSnmpTrapFwdServerDetailsResultRegisteredDevice]
    shared_scope str
    Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
    site_name str
    Name of the APIC site from which this data is being collected.
    tags Sequence[GetNiatelemetryApicSnmpTrapFwdServerDetailsResultTag]
    version_contexts Sequence[GetNiatelemetryApicSnmpTrapFwdServerDetailsResultVersionContext]
    accountMoid String
    The Account ID for this managed object.
    additionalProperties String
    address String
    Address of SNMP Trap Fwd Server in APIC.
    ancestors List<Property Map>
    classId String
    createTime String
    The time when this managed object was created.
    dn String
    Dn of the SNMP Trap Fwd Server details in APIC.
    domainGroupMoid String
    The DomainGroup ID for this managed object.
    modTime String
    The time when this managed object was last modified.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    owners List<String>
    parents List<Property Map>
    permissionResources List<Property Map>
    polDn String
    Dn of the parent SNMP Policy in APIC.
    recordType String
    Type of record DCNM / APIC / SE. This determines the type of platform where inventory was collected.
    recordVersion String
    Version of record being pushed. This determines what was the API version for data available from the device.
    registeredDevices List<Property Map>
    sharedScope String
    Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
    siteName String
    Name of the APIC site from which this data is being collected.
    tags List<Property Map>
    versionContexts List<Property Map>

    GetNiatelemetryApicSnmpTrapFwdServerDetailsResultAncestor

    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    additional_properties string
    class_id string
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    selector string
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String
    additionalProperties string
    classId string
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    selector string
    additional_properties str
    class_id str
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    selector str
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String

    GetNiatelemetryApicSnmpTrapFwdServerDetailsResultParent

    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    additional_properties string
    class_id string
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    selector string
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String
    additionalProperties string
    classId string
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    selector string
    additional_properties str
    class_id str
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    selector str
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String

    GetNiatelemetryApicSnmpTrapFwdServerDetailsResultPermissionResource

    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    additional_properties string
    class_id string
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    selector string
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String
    additionalProperties string
    classId string
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    selector string
    additional_properties str
    class_id str
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    selector str
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String

    GetNiatelemetryApicSnmpTrapFwdServerDetailsResultRegisteredDevice

    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    additional_properties string
    class_id string
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    selector string
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String
    additionalProperties string
    classId string
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    selector string
    additional_properties str
    class_id str
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    selector str
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String

    GetNiatelemetryApicSnmpTrapFwdServerDetailsResultTag

    GetNiatelemetryApicSnmpTrapFwdServerDetailsResultTagAncestorDefinition

    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    additional_properties string
    class_id string
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    selector string
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String
    additionalProperties string
    classId string
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    selector string
    additional_properties str
    class_id str
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    selector str
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String

    GetNiatelemetryApicSnmpTrapFwdServerDetailsResultTagDefinition

    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    additional_properties string
    class_id string
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    selector string
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String
    additionalProperties string
    classId string
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    selector string
    additional_properties str
    class_id str
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    selector str
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String

    GetNiatelemetryApicSnmpTrapFwdServerDetailsResultVersionContext

    GetNiatelemetryApicSnmpTrapFwdServerDetailsResultVersionContextInterestedMo

    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    additional_properties string
    class_id string
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    selector string
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String
    additionalProperties string
    classId string
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    selector string
    additional_properties str
    class_id str
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    selector str
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String

    GetNiatelemetryApicSnmpTrapFwdServerDetailsResultVersionContextRefMo

    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    additional_properties string
    class_id string
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    selector string
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String
    additionalProperties string
    classId string
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    selector string
    additional_properties str
    class_id str
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    selector str
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String

    GetNiatelemetryApicSnmpTrapFwdServerDetailsTag

    AdditionalProperties string
    AncestorDefinitions List<GetNiatelemetryApicSnmpTrapFwdServerDetailsTagAncestorDefinition>
    Definition GetNiatelemetryApicSnmpTrapFwdServerDetailsTagDefinition
    The definition is a reference to the tag definition object. The tag definition object contains the properties of the tag such as name, type, and description.
    Key string
    The string representation of a tag key.
    Propagated bool
    Propagated is a boolean flag that indicates whether the tag is propagated to the related managed objects.
    SysTag bool
    Specifies whether the tag is user-defined or owned by the system.
    Type string
    An enum type that defines the type of tag. Supported values are 'pathtag' and 'keyvalue'.

    • KeyValue - KeyValue type of tag. Key is required for these tags. Value is optional.
    • PathTag - Key contain path information. Value is not present for these tags. The path is created by using the '/' character as a delimiter.For example, if the tag is "A/B/C", then "A" is the parent tag, "B" is the child tag of "A" and "C" is the child tag of "B".
    Value string
    The string representation of a tag value.
    AdditionalProperties string
    AncestorDefinitions []GetNiatelemetryApicSnmpTrapFwdServerDetailsTagAncestorDefinition
    Definition GetNiatelemetryApicSnmpTrapFwdServerDetailsTagDefinition
    The definition is a reference to the tag definition object. The tag definition object contains the properties of the tag such as name, type, and description.
    Key string
    The string representation of a tag key.
    Propagated bool
    Propagated is a boolean flag that indicates whether the tag is propagated to the related managed objects.
    SysTag bool
    Specifies whether the tag is user-defined or owned by the system.
    Type string
    An enum type that defines the type of tag. Supported values are 'pathtag' and 'keyvalue'.

    • KeyValue - KeyValue type of tag. Key is required for these tags. Value is optional.
    • PathTag - Key contain path information. Value is not present for these tags. The path is created by using the '/' character as a delimiter.For example, if the tag is "A/B/C", then "A" is the parent tag, "B" is the child tag of "A" and "C" is the child tag of "B".
    Value string
    The string representation of a tag value.
    additional_properties string
    ancestor_definitions list(object)
    definition object
    The definition is a reference to the tag definition object. The tag definition object contains the properties of the tag such as name, type, and description.
    key string
    The string representation of a tag key.
    propagated bool
    Propagated is a boolean flag that indicates whether the tag is propagated to the related managed objects.
    sys_tag bool
    Specifies whether the tag is user-defined or owned by the system.
    type string
    An enum type that defines the type of tag. Supported values are 'pathtag' and 'keyvalue'.

    • KeyValue - KeyValue type of tag. Key is required for these tags. Value is optional.
    • PathTag - Key contain path information. Value is not present for these tags. The path is created by using the '/' character as a delimiter.For example, if the tag is "A/B/C", then "A" is the parent tag, "B" is the child tag of "A" and "C" is the child tag of "B".
    value string
    The string representation of a tag value.
    additionalProperties String
    ancestorDefinitions List<GetNiatelemetryApicSnmpTrapFwdServerDetailsTagAncestorDefinition>
    definition GetNiatelemetryApicSnmpTrapFwdServerDetailsTagDefinition
    The definition is a reference to the tag definition object. The tag definition object contains the properties of the tag such as name, type, and description.
    key String
    The string representation of a tag key.
    propagated Boolean
    Propagated is a boolean flag that indicates whether the tag is propagated to the related managed objects.
    sysTag Boolean
    Specifies whether the tag is user-defined or owned by the system.
    type String
    An enum type that defines the type of tag. Supported values are 'pathtag' and 'keyvalue'.

    • KeyValue - KeyValue type of tag. Key is required for these tags. Value is optional.
    • PathTag - Key contain path information. Value is not present for these tags. The path is created by using the '/' character as a delimiter.For example, if the tag is "A/B/C", then "A" is the parent tag, "B" is the child tag of "A" and "C" is the child tag of "B".
    value String
    The string representation of a tag value.
    additionalProperties string
    ancestorDefinitions GetNiatelemetryApicSnmpTrapFwdServerDetailsTagAncestorDefinition[]
    definition GetNiatelemetryApicSnmpTrapFwdServerDetailsTagDefinition
    The definition is a reference to the tag definition object. The tag definition object contains the properties of the tag such as name, type, and description.
    key string
    The string representation of a tag key.
    propagated boolean
    Propagated is a boolean flag that indicates whether the tag is propagated to the related managed objects.
    sysTag boolean
    Specifies whether the tag is user-defined or owned by the system.
    type string
    An enum type that defines the type of tag. Supported values are 'pathtag' and 'keyvalue'.

    • KeyValue - KeyValue type of tag. Key is required for these tags. Value is optional.
    • PathTag - Key contain path information. Value is not present for these tags. The path is created by using the '/' character as a delimiter.For example, if the tag is "A/B/C", then "A" is the parent tag, "B" is the child tag of "A" and "C" is the child tag of "B".
    value string
    The string representation of a tag value.
    additional_properties str
    ancestor_definitions Sequence[GetNiatelemetryApicSnmpTrapFwdServerDetailsTagAncestorDefinition]
    definition GetNiatelemetryApicSnmpTrapFwdServerDetailsTagDefinition
    The definition is a reference to the tag definition object. The tag definition object contains the properties of the tag such as name, type, and description.
    key str
    The string representation of a tag key.
    propagated bool
    Propagated is a boolean flag that indicates whether the tag is propagated to the related managed objects.
    sys_tag bool
    Specifies whether the tag is user-defined or owned by the system.
    type str
    An enum type that defines the type of tag. Supported values are 'pathtag' and 'keyvalue'.

    • KeyValue - KeyValue type of tag. Key is required for these tags. Value is optional.
    • PathTag - Key contain path information. Value is not present for these tags. The path is created by using the '/' character as a delimiter.For example, if the tag is "A/B/C", then "A" is the parent tag, "B" is the child tag of "A" and "C" is the child tag of "B".
    value str
    The string representation of a tag value.
    additionalProperties String
    ancestorDefinitions List<Property Map>
    definition Property Map
    The definition is a reference to the tag definition object. The tag definition object contains the properties of the tag such as name, type, and description.
    key String
    The string representation of a tag key.
    propagated Boolean
    Propagated is a boolean flag that indicates whether the tag is propagated to the related managed objects.
    sysTag Boolean
    Specifies whether the tag is user-defined or owned by the system.
    type String
    An enum type that defines the type of tag. Supported values are 'pathtag' and 'keyvalue'.

    • KeyValue - KeyValue type of tag. Key is required for these tags. Value is optional.
    • PathTag - Key contain path information. Value is not present for these tags. The path is created by using the '/' character as a delimiter.For example, if the tag is "A/B/C", then "A" is the parent tag, "B" is the child tag of "A" and "C" is the child tag of "B".
    value String
    The string representation of a tag value.

    GetNiatelemetryApicSnmpTrapFwdServerDetailsTagAncestorDefinition

    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties string
    class_id string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties string
    classId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties str
    class_id str
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    The fully-qualified name of the remote type referred by this relationship.
    selector str
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.

    GetNiatelemetryApicSnmpTrapFwdServerDetailsTagDefinition

    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties string
    class_id string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties string
    classId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties str
    class_id str
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    The fully-qualified name of the remote type referred by this relationship.
    selector str
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.

    GetNiatelemetryApicSnmpTrapFwdServerDetailsVersionContext

    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    InterestedMos List<GetNiatelemetryApicSnmpTrapFwdServerDetailsVersionContextInterestedMo>
    MarkedForDeletion bool
    The flag to indicate if snapshot is marked for deletion or not. If flag is set then snapshot will be removed after the successful deployment of the policy.
    NrVersion string
    The version of the Managed Object, e.g. an incrementing number or a hash id.
    ObjectType string
    The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
    RefMo GetNiatelemetryApicSnmpTrapFwdServerDetailsVersionContextRefMo
    A reference to the original Managed Object.
    Timestamp string
    The time this versioned Managed Object was created.
    VersionType string
    Specifies type of version. Currently the only supported value is "Configured" that is used to keep track of snapshots of policies and profiles that are intended to be configured to target endpoints.

    • Modified - Version created every time an object is modified.
    • Configured - Version created every time an object is configured to the service profile.
    • Deployed - Version created for objects related to a service profile when it is deployed.
    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    InterestedMos []GetNiatelemetryApicSnmpTrapFwdServerDetailsVersionContextInterestedMo
    MarkedForDeletion bool
    The flag to indicate if snapshot is marked for deletion or not. If flag is set then snapshot will be removed after the successful deployment of the policy.
    NrVersion string
    The version of the Managed Object, e.g. an incrementing number or a hash id.
    ObjectType string
    The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
    RefMo GetNiatelemetryApicSnmpTrapFwdServerDetailsVersionContextRefMo
    A reference to the original Managed Object.
    Timestamp string
    The time this versioned Managed Object was created.
    VersionType string
    Specifies type of version. Currently the only supported value is "Configured" that is used to keep track of snapshots of policies and profiles that are intended to be configured to target endpoints.

    • Modified - Version created every time an object is modified.
    • Configured - Version created every time an object is configured to the service profile.
    • Deployed - Version created for objects related to a service profile when it is deployed.
    additional_properties string
    class_id string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    interested_mos list(object)
    marked_for_deletion bool
    The flag to indicate if snapshot is marked for deletion or not. If flag is set then snapshot will be removed after the successful deployment of the policy.
    nr_version string
    The version of the Managed Object, e.g. an incrementing number or a hash id.
    object_type string
    The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
    ref_mo object
    A reference to the original Managed Object.
    timestamp string
    The time this versioned Managed Object was created.
    version_type string
    Specifies type of version. Currently the only supported value is "Configured" that is used to keep track of snapshots of policies and profiles that are intended to be configured to target endpoints.

    • Modified - Version created every time an object is modified.
    • Configured - Version created every time an object is configured to the service profile.
    • Deployed - Version created for objects related to a service profile when it is deployed.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    interestedMos List<GetNiatelemetryApicSnmpTrapFwdServerDetailsVersionContextInterestedMo>
    markedForDeletion Boolean
    The flag to indicate if snapshot is marked for deletion or not. If flag is set then snapshot will be removed after the successful deployment of the policy.
    nrVersion String
    The version of the Managed Object, e.g. an incrementing number or a hash id.
    objectType String
    The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
    refMo GetNiatelemetryApicSnmpTrapFwdServerDetailsVersionContextRefMo
    A reference to the original Managed Object.
    timestamp String
    The time this versioned Managed Object was created.
    versionType String
    Specifies type of version. Currently the only supported value is "Configured" that is used to keep track of snapshots of policies and profiles that are intended to be configured to target endpoints.

    • Modified - Version created every time an object is modified.
    • Configured - Version created every time an object is configured to the service profile.
    • Deployed - Version created for objects related to a service profile when it is deployed.
    additionalProperties string
    classId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    interestedMos GetNiatelemetryApicSnmpTrapFwdServerDetailsVersionContextInterestedMo[]
    markedForDeletion boolean
    The flag to indicate if snapshot is marked for deletion or not. If flag is set then snapshot will be removed after the successful deployment of the policy.
    nrVersion string
    The version of the Managed Object, e.g. an incrementing number or a hash id.
    objectType string
    The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
    refMo GetNiatelemetryApicSnmpTrapFwdServerDetailsVersionContextRefMo
    A reference to the original Managed Object.
    timestamp string
    The time this versioned Managed Object was created.
    versionType string
    Specifies type of version. Currently the only supported value is "Configured" that is used to keep track of snapshots of policies and profiles that are intended to be configured to target endpoints.

    • Modified - Version created every time an object is modified.
    • Configured - Version created every time an object is configured to the service profile.
    • Deployed - Version created for objects related to a service profile when it is deployed.
    additional_properties str
    class_id str
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    interested_mos Sequence[GetNiatelemetryApicSnmpTrapFwdServerDetailsVersionContextInterestedMo]
    marked_for_deletion bool
    The flag to indicate if snapshot is marked for deletion or not. If flag is set then snapshot will be removed after the successful deployment of the policy.
    nr_version str
    The version of the Managed Object, e.g. an incrementing number or a hash id.
    object_type str
    The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
    ref_mo GetNiatelemetryApicSnmpTrapFwdServerDetailsVersionContextRefMo
    A reference to the original Managed Object.
    timestamp str
    The time this versioned Managed Object was created.
    version_type str
    Specifies type of version. Currently the only supported value is "Configured" that is used to keep track of snapshots of policies and profiles that are intended to be configured to target endpoints.

    • Modified - Version created every time an object is modified.
    • Configured - Version created every time an object is configured to the service profile.
    • Deployed - Version created for objects related to a service profile when it is deployed.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    interestedMos List<Property Map>
    markedForDeletion Boolean
    The flag to indicate if snapshot is marked for deletion or not. If flag is set then snapshot will be removed after the successful deployment of the policy.
    nrVersion String
    The version of the Managed Object, e.g. an incrementing number or a hash id.
    objectType String
    The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
    refMo Property Map
    A reference to the original Managed Object.
    timestamp String
    The time this versioned Managed Object was created.
    versionType String
    Specifies type of version. Currently the only supported value is "Configured" that is used to keep track of snapshots of policies and profiles that are intended to be configured to target endpoints.

    • Modified - Version created every time an object is modified.
    • Configured - Version created every time an object is configured to the service profile.
    • Deployed - Version created for objects related to a service profile when it is deployed.

    GetNiatelemetryApicSnmpTrapFwdServerDetailsVersionContextInterestedMo

    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties string
    class_id string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties string
    classId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties str
    class_id str
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    The fully-qualified name of the remote type referred by this relationship.
    selector str
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.

    GetNiatelemetryApicSnmpTrapFwdServerDetailsVersionContextRefMo

    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties string
    class_id string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties string
    classId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties str
    class_id str
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    The fully-qualified name of the remote type referred by this relationship.
    selector str
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.

    Package Details

    Repository
    intersight ciscodevnet/terraform-provider-intersight
    License
    Notes
    This Pulumi package is based on the intersight Terraform Provider.
    Viewing docs for intersight 1.0.78
    published on Tuesday, Apr 21, 2026 by ciscodevnet

      Try Pulumi Cloud free.
      Your team will thank you.

      Start free trial