1. Packages
  2. Packages
  3. Intersight Provider
  4. API Docs
  5. getWorkflowServiceItemHealthCheckDefinition
Viewing docs for intersight 1.0.78
published on Tuesday, Apr 21, 2026 by ciscodevnet
Viewing docs for intersight 1.0.78
published on Tuesday, Apr 21, 2026 by ciscodevnet

    Service item health check definition metadata.

    Using getWorkflowServiceItemHealthCheckDefinition

    Two invocation forms are available. The direct form accepts plain arguments and either blocks until the result value is available, or returns a Promise-wrapped result. The output form accepts Input-wrapped arguments and returns an Output-wrapped result.

    function getWorkflowServiceItemHealthCheckDefinition(args: GetWorkflowServiceItemHealthCheckDefinitionArgs, opts?: InvokeOptions): Promise<GetWorkflowServiceItemHealthCheckDefinitionResult>
    function getWorkflowServiceItemHealthCheckDefinitionOutput(args: GetWorkflowServiceItemHealthCheckDefinitionOutputArgs, opts?: InvokeOptions): Output<GetWorkflowServiceItemHealthCheckDefinitionResult>
    def get_workflow_service_item_health_check_definition(account_moid: Optional[str] = None,
                                                          additional_properties: Optional[str] = None,
                                                          ancestors: Optional[Sequence[GetWorkflowServiceItemHealthCheckDefinitionAncestor]] = None,
                                                          category: Optional[str] = None,
                                                          class_id: Optional[str] = None,
                                                          common_cause_and_resolution: Optional[str] = None,
                                                          create_time: Optional[str] = None,
                                                          description: Optional[str] = None,
                                                          domain_group_moid: Optional[str] = None,
                                                          execution_mode: Optional[str] = None,
                                                          health_check_workflow: Optional[GetWorkflowServiceItemHealthCheckDefinitionHealthCheckWorkflow] = None,
                                                          id: Optional[str] = None,
                                                          label: Optional[str] = None,
                                                          mod_time: Optional[str] = None,
                                                          moid: Optional[str] = None,
                                                          name: Optional[str] = None,
                                                          object_type: Optional[str] = None,
                                                          owners: Optional[Sequence[str]] = None,
                                                          parent: Optional[GetWorkflowServiceItemHealthCheckDefinitionParent] = None,
                                                          permission_resources: Optional[Sequence[GetWorkflowServiceItemHealthCheckDefinitionPermissionResource]] = None,
                                                          service_item_definition: Optional[GetWorkflowServiceItemHealthCheckDefinitionServiceItemDefinition] = None,
                                                          shared_scope: Optional[str] = None,
                                                          tags: Optional[Sequence[GetWorkflowServiceItemHealthCheckDefinitionTag]] = None,
                                                          version_context: Optional[GetWorkflowServiceItemHealthCheckDefinitionVersionContext] = None,
                                                          opts: Optional[InvokeOptions] = None) -> GetWorkflowServiceItemHealthCheckDefinitionResult
    def get_workflow_service_item_health_check_definition_output(account_moid: pulumi.Input[Optional[str]] = None,
                                                          additional_properties: pulumi.Input[Optional[str]] = None,
                                                          ancestors: pulumi.Input[Optional[Sequence[pulumi.Input[GetWorkflowServiceItemHealthCheckDefinitionAncestorArgs]]]] = None,
                                                          category: pulumi.Input[Optional[str]] = None,
                                                          class_id: pulumi.Input[Optional[str]] = None,
                                                          common_cause_and_resolution: pulumi.Input[Optional[str]] = None,
                                                          create_time: pulumi.Input[Optional[str]] = None,
                                                          description: pulumi.Input[Optional[str]] = None,
                                                          domain_group_moid: pulumi.Input[Optional[str]] = None,
                                                          execution_mode: pulumi.Input[Optional[str]] = None,
                                                          health_check_workflow: pulumi.Input[Optional[GetWorkflowServiceItemHealthCheckDefinitionHealthCheckWorkflowArgs]] = None,
                                                          id: pulumi.Input[Optional[str]] = None,
                                                          label: pulumi.Input[Optional[str]] = None,
                                                          mod_time: pulumi.Input[Optional[str]] = None,
                                                          moid: pulumi.Input[Optional[str]] = None,
                                                          name: pulumi.Input[Optional[str]] = None,
                                                          object_type: pulumi.Input[Optional[str]] = None,
                                                          owners: pulumi.Input[Optional[Sequence[pulumi.Input[str]]]] = None,
                                                          parent: pulumi.Input[Optional[GetWorkflowServiceItemHealthCheckDefinitionParentArgs]] = None,
                                                          permission_resources: pulumi.Input[Optional[Sequence[pulumi.Input[GetWorkflowServiceItemHealthCheckDefinitionPermissionResourceArgs]]]] = None,
                                                          service_item_definition: pulumi.Input[Optional[GetWorkflowServiceItemHealthCheckDefinitionServiceItemDefinitionArgs]] = None,
                                                          shared_scope: pulumi.Input[Optional[str]] = None,
                                                          tags: pulumi.Input[Optional[Sequence[pulumi.Input[GetWorkflowServiceItemHealthCheckDefinitionTagArgs]]]] = None,
                                                          version_context: pulumi.Input[Optional[GetWorkflowServiceItemHealthCheckDefinitionVersionContextArgs]] = None,
                                                          opts: Optional[InvokeOptions] = None) -> Output[GetWorkflowServiceItemHealthCheckDefinitionResult]
    func LookupWorkflowServiceItemHealthCheckDefinition(ctx *Context, args *LookupWorkflowServiceItemHealthCheckDefinitionArgs, opts ...InvokeOption) (*LookupWorkflowServiceItemHealthCheckDefinitionResult, error)
    func LookupWorkflowServiceItemHealthCheckDefinitionOutput(ctx *Context, args *LookupWorkflowServiceItemHealthCheckDefinitionOutputArgs, opts ...InvokeOption) LookupWorkflowServiceItemHealthCheckDefinitionResultOutput

    > Note: This function is named LookupWorkflowServiceItemHealthCheckDefinition in the Go SDK.

    public static class GetWorkflowServiceItemHealthCheckDefinition 
    {
        public static Task<GetWorkflowServiceItemHealthCheckDefinitionResult> InvokeAsync(GetWorkflowServiceItemHealthCheckDefinitionArgs args, InvokeOptions? opts = null)
        public static Output<GetWorkflowServiceItemHealthCheckDefinitionResult> Invoke(GetWorkflowServiceItemHealthCheckDefinitionInvokeArgs args, InvokeOptions? opts = null)
    }
    public static CompletableFuture<GetWorkflowServiceItemHealthCheckDefinitionResult> getWorkflowServiceItemHealthCheckDefinition(GetWorkflowServiceItemHealthCheckDefinitionArgs args, InvokeOptions options)
    public static Output<GetWorkflowServiceItemHealthCheckDefinitionResult> getWorkflowServiceItemHealthCheckDefinition(GetWorkflowServiceItemHealthCheckDefinitionArgs args, InvokeOptions options)
    
    fn::invoke:
      function: intersight:index/getWorkflowServiceItemHealthCheckDefinition:getWorkflowServiceItemHealthCheckDefinition
      arguments:
        # arguments dictionary
    data "intersight_getworkflowserviceitemhealthcheckdefinition" "name" {
        # arguments
    }

    The following arguments are supported:

    AccountMoid string
    The Account ID for this managed object.
    AdditionalProperties string
    Ancestors List<GetWorkflowServiceItemHealthCheckDefinitionAncestor>
    Category string
    Category that the health check belongs to.
    ClassId string
    CommonCauseAndResolution string
    Static information detailing the common cause for the health check failure.It also gives possible remediation actions that can be taken to remedy the health check failure.
    CreateTime string
    The time when this managed object was created.
    Description string
    Description of the health check definition.
    DomainGroupMoid string
    The DomainGroup ID for this managed object.
    ExecutionMode string
    Execution mode of the health check on service item.* OnDemand - Execute the health check on-demand.* Periodic - Execute the health check on a periodic basis.
    HealthCheckWorkflow GetWorkflowServiceItemHealthCheckDefinitionHealthCheckWorkflow
    Id string
    Label string
    Label for the health check definition that is displayed on UI.
    ModTime string
    The time when this managed object was last modified.
    Moid string
    The unique identifier of this Managed Object instance.
    Name string
    Name of the health check definition.
    ObjectType string
    Owners List<string>
    Parent GetWorkflowServiceItemHealthCheckDefinitionParent
    PermissionResources List<GetWorkflowServiceItemHealthCheckDefinitionPermissionResource>
    ServiceItemDefinition GetWorkflowServiceItemHealthCheckDefinitionServiceItemDefinition
    SharedScope string
    Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
    Tags List<GetWorkflowServiceItemHealthCheckDefinitionTag>
    VersionContext GetWorkflowServiceItemHealthCheckDefinitionVersionContext
    AccountMoid string
    The Account ID for this managed object.
    AdditionalProperties string
    Ancestors []GetWorkflowServiceItemHealthCheckDefinitionAncestor
    Category string
    Category that the health check belongs to.
    ClassId string
    CommonCauseAndResolution string
    Static information detailing the common cause for the health check failure.It also gives possible remediation actions that can be taken to remedy the health check failure.
    CreateTime string
    The time when this managed object was created.
    Description string
    Description of the health check definition.
    DomainGroupMoid string
    The DomainGroup ID for this managed object.
    ExecutionMode string
    Execution mode of the health check on service item.* OnDemand - Execute the health check on-demand.* Periodic - Execute the health check on a periodic basis.
    HealthCheckWorkflow GetWorkflowServiceItemHealthCheckDefinitionHealthCheckWorkflow
    Id string
    Label string
    Label for the health check definition that is displayed on UI.
    ModTime string
    The time when this managed object was last modified.
    Moid string
    The unique identifier of this Managed Object instance.
    Name string
    Name of the health check definition.
    ObjectType string
    Owners []string
    Parent GetWorkflowServiceItemHealthCheckDefinitionParent
    PermissionResources []GetWorkflowServiceItemHealthCheckDefinitionPermissionResource
    ServiceItemDefinition GetWorkflowServiceItemHealthCheckDefinitionServiceItemDefinition
    SharedScope string
    Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
    Tags []GetWorkflowServiceItemHealthCheckDefinitionTag
    VersionContext GetWorkflowServiceItemHealthCheckDefinitionVersionContext
    account_moid string
    The Account ID for this managed object.
    additional_properties string
    ancestors list(object)
    category string
    Category that the health check belongs to.
    class_id string
    common_cause_and_resolution string
    Static information detailing the common cause for the health check failure.It also gives possible remediation actions that can be taken to remedy the health check failure.
    create_time string
    The time when this managed object was created.
    description string
    Description of the health check definition.
    domain_group_moid string
    The DomainGroup ID for this managed object.
    execution_mode string
    Execution mode of the health check on service item.* OnDemand - Execute the health check on-demand.* Periodic - Execute the health check on a periodic basis.
    health_check_workflow object
    id string
    label string
    Label for the health check definition that is displayed on UI.
    mod_time string
    The time when this managed object was last modified.
    moid string
    The unique identifier of this Managed Object instance.
    name string
    Name of the health check definition.
    object_type string
    owners list(string)
    parent object
    permission_resources list(object)
    service_item_definition object
    shared_scope string
    Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
    tags list(object)
    version_context object
    accountMoid String
    The Account ID for this managed object.
    additionalProperties String
    ancestors List<GetWorkflowServiceItemHealthCheckDefinitionAncestor>
    category String
    Category that the health check belongs to.
    classId String
    commonCauseAndResolution String
    Static information detailing the common cause for the health check failure.It also gives possible remediation actions that can be taken to remedy the health check failure.
    createTime String
    The time when this managed object was created.
    description String
    Description of the health check definition.
    domainGroupMoid String
    The DomainGroup ID for this managed object.
    executionMode String
    Execution mode of the health check on service item.* OnDemand - Execute the health check on-demand.* Periodic - Execute the health check on a periodic basis.
    healthCheckWorkflow GetWorkflowServiceItemHealthCheckDefinitionHealthCheckWorkflow
    id String
    label String
    Label for the health check definition that is displayed on UI.
    modTime String
    The time when this managed object was last modified.
    moid String
    The unique identifier of this Managed Object instance.
    name String
    Name of the health check definition.
    objectType String
    owners List<String>
    parent GetWorkflowServiceItemHealthCheckDefinitionParent
    permissionResources List<GetWorkflowServiceItemHealthCheckDefinitionPermissionResource>
    serviceItemDefinition GetWorkflowServiceItemHealthCheckDefinitionServiceItemDefinition
    sharedScope String
    Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
    tags List<GetWorkflowServiceItemHealthCheckDefinitionTag>
    versionContext GetWorkflowServiceItemHealthCheckDefinitionVersionContext
    accountMoid string
    The Account ID for this managed object.
    additionalProperties string
    ancestors GetWorkflowServiceItemHealthCheckDefinitionAncestor[]
    category string
    Category that the health check belongs to.
    classId string
    commonCauseAndResolution string
    Static information detailing the common cause for the health check failure.It also gives possible remediation actions that can be taken to remedy the health check failure.
    createTime string
    The time when this managed object was created.
    description string
    Description of the health check definition.
    domainGroupMoid string
    The DomainGroup ID for this managed object.
    executionMode string
    Execution mode of the health check on service item.* OnDemand - Execute the health check on-demand.* Periodic - Execute the health check on a periodic basis.
    healthCheckWorkflow GetWorkflowServiceItemHealthCheckDefinitionHealthCheckWorkflow
    id string
    label string
    Label for the health check definition that is displayed on UI.
    modTime string
    The time when this managed object was last modified.
    moid string
    The unique identifier of this Managed Object instance.
    name string
    Name of the health check definition.
    objectType string
    owners string[]
    parent GetWorkflowServiceItemHealthCheckDefinitionParent
    permissionResources GetWorkflowServiceItemHealthCheckDefinitionPermissionResource[]
    serviceItemDefinition GetWorkflowServiceItemHealthCheckDefinitionServiceItemDefinition
    sharedScope string
    Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
    tags GetWorkflowServiceItemHealthCheckDefinitionTag[]
    versionContext GetWorkflowServiceItemHealthCheckDefinitionVersionContext
    account_moid str
    The Account ID for this managed object.
    additional_properties str
    ancestors Sequence[GetWorkflowServiceItemHealthCheckDefinitionAncestor]
    category str
    Category that the health check belongs to.
    class_id str
    common_cause_and_resolution str
    Static information detailing the common cause for the health check failure.It also gives possible remediation actions that can be taken to remedy the health check failure.
    create_time str
    The time when this managed object was created.
    description str
    Description of the health check definition.
    domain_group_moid str
    The DomainGroup ID for this managed object.
    execution_mode str
    Execution mode of the health check on service item.* OnDemand - Execute the health check on-demand.* Periodic - Execute the health check on a periodic basis.
    health_check_workflow GetWorkflowServiceItemHealthCheckDefinitionHealthCheckWorkflow
    id str
    label str
    Label for the health check definition that is displayed on UI.
    mod_time str
    The time when this managed object was last modified.
    moid str
    The unique identifier of this Managed Object instance.
    name str
    Name of the health check definition.
    object_type str
    owners Sequence[str]
    parent GetWorkflowServiceItemHealthCheckDefinitionParent
    permission_resources Sequence[GetWorkflowServiceItemHealthCheckDefinitionPermissionResource]
    service_item_definition GetWorkflowServiceItemHealthCheckDefinitionServiceItemDefinition
    shared_scope str
    Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
    tags Sequence[GetWorkflowServiceItemHealthCheckDefinitionTag]
    version_context GetWorkflowServiceItemHealthCheckDefinitionVersionContext
    accountMoid String
    The Account ID for this managed object.
    additionalProperties String
    ancestors List<Property Map>
    category String
    Category that the health check belongs to.
    classId String
    commonCauseAndResolution String
    Static information detailing the common cause for the health check failure.It also gives possible remediation actions that can be taken to remedy the health check failure.
    createTime String
    The time when this managed object was created.
    description String
    Description of the health check definition.
    domainGroupMoid String
    The DomainGroup ID for this managed object.
    executionMode String
    Execution mode of the health check on service item.* OnDemand - Execute the health check on-demand.* Periodic - Execute the health check on a periodic basis.
    healthCheckWorkflow Property Map
    id String
    label String
    Label for the health check definition that is displayed on UI.
    modTime String
    The time when this managed object was last modified.
    moid String
    The unique identifier of this Managed Object instance.
    name String
    Name of the health check definition.
    objectType String
    owners List<String>
    parent Property Map
    permissionResources List<Property Map>
    serviceItemDefinition Property Map
    sharedScope String
    Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
    tags List<Property Map>
    versionContext Property Map

    getWorkflowServiceItemHealthCheckDefinition Result

    The following output properties are available:

    Id string
    Results List<GetWorkflowServiceItemHealthCheckDefinitionResult>
    AccountMoid string
    AdditionalProperties string
    Ancestors List<GetWorkflowServiceItemHealthCheckDefinitionAncestor>
    Category string
    ClassId string
    CommonCauseAndResolution string
    CreateTime string
    Description string
    DomainGroupMoid string
    ExecutionMode string
    HealthCheckWorkflow GetWorkflowServiceItemHealthCheckDefinitionHealthCheckWorkflow
    Label string
    ModTime string
    Moid string
    Name string
    ObjectType string
    Owners List<string>
    Parent GetWorkflowServiceItemHealthCheckDefinitionParent
    PermissionResources List<GetWorkflowServiceItemHealthCheckDefinitionPermissionResource>
    ServiceItemDefinition GetWorkflowServiceItemHealthCheckDefinitionServiceItemDefinition
    SharedScope string
    Tags List<GetWorkflowServiceItemHealthCheckDefinitionTag>
    VersionContext GetWorkflowServiceItemHealthCheckDefinitionVersionContext
    Id string
    Results []GetWorkflowServiceItemHealthCheckDefinitionResult
    AccountMoid string
    AdditionalProperties string
    Ancestors []GetWorkflowServiceItemHealthCheckDefinitionAncestor
    Category string
    ClassId string
    CommonCauseAndResolution string
    CreateTime string
    Description string
    DomainGroupMoid string
    ExecutionMode string
    HealthCheckWorkflow GetWorkflowServiceItemHealthCheckDefinitionHealthCheckWorkflow
    Label string
    ModTime string
    Moid string
    Name string
    ObjectType string
    Owners []string
    Parent GetWorkflowServiceItemHealthCheckDefinitionParent
    PermissionResources []GetWorkflowServiceItemHealthCheckDefinitionPermissionResource
    ServiceItemDefinition GetWorkflowServiceItemHealthCheckDefinitionServiceItemDefinition
    SharedScope string
    Tags []GetWorkflowServiceItemHealthCheckDefinitionTag
    VersionContext GetWorkflowServiceItemHealthCheckDefinitionVersionContext
    id String
    results List<GetWorkflowServiceItemHealthCheckDefinitionResult>
    accountMoid String
    additionalProperties String
    ancestors List<GetWorkflowServiceItemHealthCheckDefinitionAncestor>
    category String
    classId String
    commonCauseAndResolution String
    createTime String
    description String
    domainGroupMoid String
    executionMode String
    healthCheckWorkflow GetWorkflowServiceItemHealthCheckDefinitionHealthCheckWorkflow
    label String
    modTime String
    moid String
    name String
    objectType String
    owners List<String>
    parent GetWorkflowServiceItemHealthCheckDefinitionParent
    permissionResources List<GetWorkflowServiceItemHealthCheckDefinitionPermissionResource>
    serviceItemDefinition GetWorkflowServiceItemHealthCheckDefinitionServiceItemDefinition
    sharedScope String
    tags List<GetWorkflowServiceItemHealthCheckDefinitionTag>
    versionContext GetWorkflowServiceItemHealthCheckDefinitionVersionContext
    id string
    results GetWorkflowServiceItemHealthCheckDefinitionResult[]
    accountMoid string
    additionalProperties string
    ancestors GetWorkflowServiceItemHealthCheckDefinitionAncestor[]
    category string
    classId string
    commonCauseAndResolution string
    createTime string
    description string
    domainGroupMoid string
    executionMode string
    healthCheckWorkflow GetWorkflowServiceItemHealthCheckDefinitionHealthCheckWorkflow
    label string
    modTime string
    moid string
    name string
    objectType string
    owners string[]
    parent GetWorkflowServiceItemHealthCheckDefinitionParent
    permissionResources GetWorkflowServiceItemHealthCheckDefinitionPermissionResource[]
    serviceItemDefinition GetWorkflowServiceItemHealthCheckDefinitionServiceItemDefinition
    sharedScope string
    tags GetWorkflowServiceItemHealthCheckDefinitionTag[]
    versionContext GetWorkflowServiceItemHealthCheckDefinitionVersionContext
    id str
    results Sequence[GetWorkflowServiceItemHealthCheckDefinitionResult]
    account_moid str
    additional_properties str
    ancestors Sequence[GetWorkflowServiceItemHealthCheckDefinitionAncestor]
    category str
    class_id str
    common_cause_and_resolution str
    create_time str
    description str
    domain_group_moid str
    execution_mode str
    health_check_workflow GetWorkflowServiceItemHealthCheckDefinitionHealthCheckWorkflow
    label str
    mod_time str
    moid str
    name str
    object_type str
    owners Sequence[str]
    parent GetWorkflowServiceItemHealthCheckDefinitionParent
    permission_resources Sequence[GetWorkflowServiceItemHealthCheckDefinitionPermissionResource]
    service_item_definition GetWorkflowServiceItemHealthCheckDefinitionServiceItemDefinition
    shared_scope str
    tags Sequence[GetWorkflowServiceItemHealthCheckDefinitionTag]
    version_context GetWorkflowServiceItemHealthCheckDefinitionVersionContext

    Supporting Types

    GetWorkflowServiceItemHealthCheckDefinitionAncestor

    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties string
    class_id string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties string
    classId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties str
    class_id str
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    The fully-qualified name of the remote type referred by this relationship.
    selector str
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.

    GetWorkflowServiceItemHealthCheckDefinitionHealthCheckWorkflow

    AdditionalProperties string
    CatalogMoid string
    Specify the catalog moid that this workflow belongs. When catalog moid is not specified then the catalog of the service item is used first and if no workflow can be found in that catalog, then the shared catalog from Intersight is used.
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Description string
    Description of the health check definition.
    InputParameters string
    Capture the mapping of ActionDefinition inputDefinition to workflow definition.
    Label string
    Label for the health check definition that is displayed on UI.
    Name string
    Name of the health check definition.
    NrVersion double
    The workflow definition version to use as subworkflow. When no version is specified then the default version of the workflow at the time of creating or updating this workflow is used.
    ObjectType string
    The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
    WorkflowDefinition GetWorkflowServiceItemHealthCheckDefinitionHealthCheckWorkflowWorkflowDefinition
    The moid of the workflow definition.
    WorkflowDefinitionName string
    The qualified name of workflow that should be executed.
    AdditionalProperties string
    CatalogMoid string
    Specify the catalog moid that this workflow belongs. When catalog moid is not specified then the catalog of the service item is used first and if no workflow can be found in that catalog, then the shared catalog from Intersight is used.
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Description string
    Description of the health check definition.
    InputParameters string
    Capture the mapping of ActionDefinition inputDefinition to workflow definition.
    Label string
    Label for the health check definition that is displayed on UI.
    Name string
    Name of the health check definition.
    NrVersion float64
    The workflow definition version to use as subworkflow. When no version is specified then the default version of the workflow at the time of creating or updating this workflow is used.
    ObjectType string
    The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
    WorkflowDefinition GetWorkflowServiceItemHealthCheckDefinitionHealthCheckWorkflowWorkflowDefinition
    The moid of the workflow definition.
    WorkflowDefinitionName string
    The qualified name of workflow that should be executed.
    additional_properties string
    catalog_moid string
    Specify the catalog moid that this workflow belongs. When catalog moid is not specified then the catalog of the service item is used first and if no workflow can be found in that catalog, then the shared catalog from Intersight is used.
    class_id string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    description string
    Description of the health check definition.
    input_parameters string
    Capture the mapping of ActionDefinition inputDefinition to workflow definition.
    label string
    Label for the health check definition that is displayed on UI.
    name string
    Name of the health check definition.
    nr_version number
    The workflow definition version to use as subworkflow. When no version is specified then the default version of the workflow at the time of creating or updating this workflow is used.
    object_type string
    The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
    workflow_definition object
    The moid of the workflow definition.
    workflow_definition_name string
    The qualified name of workflow that should be executed.
    additionalProperties String
    catalogMoid String
    Specify the catalog moid that this workflow belongs. When catalog moid is not specified then the catalog of the service item is used first and if no workflow can be found in that catalog, then the shared catalog from Intersight is used.
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    description String
    Description of the health check definition.
    inputParameters String
    Capture the mapping of ActionDefinition inputDefinition to workflow definition.
    label String
    Label for the health check definition that is displayed on UI.
    name String
    Name of the health check definition.
    nrVersion Double
    The workflow definition version to use as subworkflow. When no version is specified then the default version of the workflow at the time of creating or updating this workflow is used.
    objectType String
    The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
    workflowDefinition GetWorkflowServiceItemHealthCheckDefinitionHealthCheckWorkflowWorkflowDefinition
    The moid of the workflow definition.
    workflowDefinitionName String
    The qualified name of workflow that should be executed.
    additionalProperties string
    catalogMoid string
    Specify the catalog moid that this workflow belongs. When catalog moid is not specified then the catalog of the service item is used first and if no workflow can be found in that catalog, then the shared catalog from Intersight is used.
    classId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    description string
    Description of the health check definition.
    inputParameters string
    Capture the mapping of ActionDefinition inputDefinition to workflow definition.
    label string
    Label for the health check definition that is displayed on UI.
    name string
    Name of the health check definition.
    nrVersion number
    The workflow definition version to use as subworkflow. When no version is specified then the default version of the workflow at the time of creating or updating this workflow is used.
    objectType string
    The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
    workflowDefinition GetWorkflowServiceItemHealthCheckDefinitionHealthCheckWorkflowWorkflowDefinition
    The moid of the workflow definition.
    workflowDefinitionName string
    The qualified name of workflow that should be executed.
    additional_properties str
    catalog_moid str
    Specify the catalog moid that this workflow belongs. When catalog moid is not specified then the catalog of the service item is used first and if no workflow can be found in that catalog, then the shared catalog from Intersight is used.
    class_id str
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    description str
    Description of the health check definition.
    input_parameters str
    Capture the mapping of ActionDefinition inputDefinition to workflow definition.
    label str
    Label for the health check definition that is displayed on UI.
    name str
    Name of the health check definition.
    nr_version float
    The workflow definition version to use as subworkflow. When no version is specified then the default version of the workflow at the time of creating or updating this workflow is used.
    object_type str
    The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
    workflow_definition GetWorkflowServiceItemHealthCheckDefinitionHealthCheckWorkflowWorkflowDefinition
    The moid of the workflow definition.
    workflow_definition_name str
    The qualified name of workflow that should be executed.
    additionalProperties String
    catalogMoid String
    Specify the catalog moid that this workflow belongs. When catalog moid is not specified then the catalog of the service item is used first and if no workflow can be found in that catalog, then the shared catalog from Intersight is used.
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    description String
    Description of the health check definition.
    inputParameters String
    Capture the mapping of ActionDefinition inputDefinition to workflow definition.
    label String
    Label for the health check definition that is displayed on UI.
    name String
    Name of the health check definition.
    nrVersion Number
    The workflow definition version to use as subworkflow. When no version is specified then the default version of the workflow at the time of creating or updating this workflow is used.
    objectType String
    The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
    workflowDefinition Property Map
    The moid of the workflow definition.
    workflowDefinitionName String
    The qualified name of workflow that should be executed.

    GetWorkflowServiceItemHealthCheckDefinitionHealthCheckWorkflowWorkflowDefinition

    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties string
    class_id string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties string
    classId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties str
    class_id str
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    The fully-qualified name of the remote type referred by this relationship.
    selector str
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.

    GetWorkflowServiceItemHealthCheckDefinitionParent

    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties string
    class_id string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties string
    classId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties str
    class_id str
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    The fully-qualified name of the remote type referred by this relationship.
    selector str
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.

    GetWorkflowServiceItemHealthCheckDefinitionPermissionResource

    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties string
    class_id string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties string
    classId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties str
    class_id str
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    The fully-qualified name of the remote type referred by this relationship.
    selector str
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.

    GetWorkflowServiceItemHealthCheckDefinitionResult

    AccountMoid string
    The Account ID for this managed object.
    AdditionalProperties string
    Ancestors List<GetWorkflowServiceItemHealthCheckDefinitionResultAncestor>
    Category string
    Category that the health check belongs to.
    ClassId string
    CommonCauseAndResolution string
    Static information detailing the common cause for the health check failure.It also gives possible remediation actions that can be taken to remedy the health check failure.
    CreateTime string
    The time when this managed object was created.
    Description string
    Description of the health check definition.
    DomainGroupMoid string
    The DomainGroup ID for this managed object.
    ExecutionMode string
    Execution mode of the health check on service item.* OnDemand - Execute the health check on-demand.* Periodic - Execute the health check on a periodic basis.
    HealthCheckWorkflows List<GetWorkflowServiceItemHealthCheckDefinitionResultHealthCheckWorkflow>
    Label string
    Label for the health check definition that is displayed on UI.
    ModTime string
    The time when this managed object was last modified.
    Moid string
    The unique identifier of this Managed Object instance.
    Name string
    Name of the health check definition.
    ObjectType string
    Owners List<string>
    Parents List<GetWorkflowServiceItemHealthCheckDefinitionResultParent>
    PermissionResources List<GetWorkflowServiceItemHealthCheckDefinitionResultPermissionResource>
    ServiceItemDefinitions List<GetWorkflowServiceItemHealthCheckDefinitionResultServiceItemDefinition>
    SharedScope string
    Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
    Tags List<GetWorkflowServiceItemHealthCheckDefinitionResultTag>
    VersionContexts List<GetWorkflowServiceItemHealthCheckDefinitionResultVersionContext>
    AccountMoid string
    The Account ID for this managed object.
    AdditionalProperties string
    Ancestors []GetWorkflowServiceItemHealthCheckDefinitionResultAncestor
    Category string
    Category that the health check belongs to.
    ClassId string
    CommonCauseAndResolution string
    Static information detailing the common cause for the health check failure.It also gives possible remediation actions that can be taken to remedy the health check failure.
    CreateTime string
    The time when this managed object was created.
    Description string
    Description of the health check definition.
    DomainGroupMoid string
    The DomainGroup ID for this managed object.
    ExecutionMode string
    Execution mode of the health check on service item.* OnDemand - Execute the health check on-demand.* Periodic - Execute the health check on a periodic basis.
    HealthCheckWorkflows []GetWorkflowServiceItemHealthCheckDefinitionResultHealthCheckWorkflow
    Label string
    Label for the health check definition that is displayed on UI.
    ModTime string
    The time when this managed object was last modified.
    Moid string
    The unique identifier of this Managed Object instance.
    Name string
    Name of the health check definition.
    ObjectType string
    Owners []string
    Parents []GetWorkflowServiceItemHealthCheckDefinitionResultParent
    PermissionResources []GetWorkflowServiceItemHealthCheckDefinitionResultPermissionResource
    ServiceItemDefinitions []GetWorkflowServiceItemHealthCheckDefinitionResultServiceItemDefinition
    SharedScope string
    Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
    Tags []GetWorkflowServiceItemHealthCheckDefinitionResultTag
    VersionContexts []GetWorkflowServiceItemHealthCheckDefinitionResultVersionContext
    account_moid string
    The Account ID for this managed object.
    additional_properties string
    ancestors list(object)
    category string
    Category that the health check belongs to.
    class_id string
    common_cause_and_resolution string
    Static information detailing the common cause for the health check failure.It also gives possible remediation actions that can be taken to remedy the health check failure.
    create_time string
    The time when this managed object was created.
    description string
    Description of the health check definition.
    domain_group_moid string
    The DomainGroup ID for this managed object.
    execution_mode string
    Execution mode of the health check on service item.* OnDemand - Execute the health check on-demand.* Periodic - Execute the health check on a periodic basis.
    health_check_workflows list(object)
    label string
    Label for the health check definition that is displayed on UI.
    mod_time string
    The time when this managed object was last modified.
    moid string
    The unique identifier of this Managed Object instance.
    name string
    Name of the health check definition.
    object_type string
    owners list(string)
    parents list(object)
    permission_resources list(object)
    service_item_definitions list(object)
    shared_scope string
    Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
    tags list(object)
    version_contexts list(object)
    accountMoid String
    The Account ID for this managed object.
    additionalProperties String
    ancestors List<GetWorkflowServiceItemHealthCheckDefinitionResultAncestor>
    category String
    Category that the health check belongs to.
    classId String
    commonCauseAndResolution String
    Static information detailing the common cause for the health check failure.It also gives possible remediation actions that can be taken to remedy the health check failure.
    createTime String
    The time when this managed object was created.
    description String
    Description of the health check definition.
    domainGroupMoid String
    The DomainGroup ID for this managed object.
    executionMode String
    Execution mode of the health check on service item.* OnDemand - Execute the health check on-demand.* Periodic - Execute the health check on a periodic basis.
    healthCheckWorkflows List<GetWorkflowServiceItemHealthCheckDefinitionResultHealthCheckWorkflow>
    label String
    Label for the health check definition that is displayed on UI.
    modTime String
    The time when this managed object was last modified.
    moid String
    The unique identifier of this Managed Object instance.
    name String
    Name of the health check definition.
    objectType String
    owners List<String>
    parents List<GetWorkflowServiceItemHealthCheckDefinitionResultParent>
    permissionResources List<GetWorkflowServiceItemHealthCheckDefinitionResultPermissionResource>
    serviceItemDefinitions List<GetWorkflowServiceItemHealthCheckDefinitionResultServiceItemDefinition>
    sharedScope String
    Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
    tags List<GetWorkflowServiceItemHealthCheckDefinitionResultTag>
    versionContexts List<GetWorkflowServiceItemHealthCheckDefinitionResultVersionContext>
    accountMoid string
    The Account ID for this managed object.
    additionalProperties string
    ancestors GetWorkflowServiceItemHealthCheckDefinitionResultAncestor[]
    category string
    Category that the health check belongs to.
    classId string
    commonCauseAndResolution string
    Static information detailing the common cause for the health check failure.It also gives possible remediation actions that can be taken to remedy the health check failure.
    createTime string
    The time when this managed object was created.
    description string
    Description of the health check definition.
    domainGroupMoid string
    The DomainGroup ID for this managed object.
    executionMode string
    Execution mode of the health check on service item.* OnDemand - Execute the health check on-demand.* Periodic - Execute the health check on a periodic basis.
    healthCheckWorkflows GetWorkflowServiceItemHealthCheckDefinitionResultHealthCheckWorkflow[]
    label string
    Label for the health check definition that is displayed on UI.
    modTime string
    The time when this managed object was last modified.
    moid string
    The unique identifier of this Managed Object instance.
    name string
    Name of the health check definition.
    objectType string
    owners string[]
    parents GetWorkflowServiceItemHealthCheckDefinitionResultParent[]
    permissionResources GetWorkflowServiceItemHealthCheckDefinitionResultPermissionResource[]
    serviceItemDefinitions GetWorkflowServiceItemHealthCheckDefinitionResultServiceItemDefinition[]
    sharedScope string
    Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
    tags GetWorkflowServiceItemHealthCheckDefinitionResultTag[]
    versionContexts GetWorkflowServiceItemHealthCheckDefinitionResultVersionContext[]
    account_moid str
    The Account ID for this managed object.
    additional_properties str
    ancestors Sequence[GetWorkflowServiceItemHealthCheckDefinitionResultAncestor]
    category str
    Category that the health check belongs to.
    class_id str
    common_cause_and_resolution str
    Static information detailing the common cause for the health check failure.It also gives possible remediation actions that can be taken to remedy the health check failure.
    create_time str
    The time when this managed object was created.
    description str
    Description of the health check definition.
    domain_group_moid str
    The DomainGroup ID for this managed object.
    execution_mode str
    Execution mode of the health check on service item.* OnDemand - Execute the health check on-demand.* Periodic - Execute the health check on a periodic basis.
    health_check_workflows Sequence[GetWorkflowServiceItemHealthCheckDefinitionResultHealthCheckWorkflow]
    label str
    Label for the health check definition that is displayed on UI.
    mod_time str
    The time when this managed object was last modified.
    moid str
    The unique identifier of this Managed Object instance.
    name str
    Name of the health check definition.
    object_type str
    owners Sequence[str]
    parents Sequence[GetWorkflowServiceItemHealthCheckDefinitionResultParent]
    permission_resources Sequence[GetWorkflowServiceItemHealthCheckDefinitionResultPermissionResource]
    service_item_definitions Sequence[GetWorkflowServiceItemHealthCheckDefinitionResultServiceItemDefinition]
    shared_scope str
    Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
    tags Sequence[GetWorkflowServiceItemHealthCheckDefinitionResultTag]
    version_contexts Sequence[GetWorkflowServiceItemHealthCheckDefinitionResultVersionContext]
    accountMoid String
    The Account ID for this managed object.
    additionalProperties String
    ancestors List<Property Map>
    category String
    Category that the health check belongs to.
    classId String
    commonCauseAndResolution String
    Static information detailing the common cause for the health check failure.It also gives possible remediation actions that can be taken to remedy the health check failure.
    createTime String
    The time when this managed object was created.
    description String
    Description of the health check definition.
    domainGroupMoid String
    The DomainGroup ID for this managed object.
    executionMode String
    Execution mode of the health check on service item.* OnDemand - Execute the health check on-demand.* Periodic - Execute the health check on a periodic basis.
    healthCheckWorkflows List<Property Map>
    label String
    Label for the health check definition that is displayed on UI.
    modTime String
    The time when this managed object was last modified.
    moid String
    The unique identifier of this Managed Object instance.
    name String
    Name of the health check definition.
    objectType String
    owners List<String>
    parents List<Property Map>
    permissionResources List<Property Map>
    serviceItemDefinitions List<Property Map>
    sharedScope String
    Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
    tags List<Property Map>
    versionContexts List<Property Map>

    GetWorkflowServiceItemHealthCheckDefinitionResultAncestor

    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    additional_properties string
    class_id string
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    selector string
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String
    additionalProperties string
    classId string
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    selector string
    additional_properties str
    class_id str
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    selector str
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String

    GetWorkflowServiceItemHealthCheckDefinitionResultHealthCheckWorkflow

    AdditionalProperties string
    CatalogMoid string
    ClassId string
    Description string
    Description of the health check definition.
    InputParameters string
    Label string
    Label for the health check definition that is displayed on UI.
    Name string
    Name of the health check definition.
    NrVersion double
    ObjectType string
    WorkflowDefinitionName string
    WorkflowDefinitions List<GetWorkflowServiceItemHealthCheckDefinitionResultHealthCheckWorkflowWorkflowDefinition>
    AdditionalProperties string
    CatalogMoid string
    ClassId string
    Description string
    Description of the health check definition.
    InputParameters string
    Label string
    Label for the health check definition that is displayed on UI.
    Name string
    Name of the health check definition.
    NrVersion float64
    ObjectType string
    WorkflowDefinitionName string
    WorkflowDefinitions []GetWorkflowServiceItemHealthCheckDefinitionResultHealthCheckWorkflowWorkflowDefinition
    additional_properties string
    catalog_moid string
    class_id string
    description string
    Description of the health check definition.
    input_parameters string
    label string
    Label for the health check definition that is displayed on UI.
    name string
    Name of the health check definition.
    nr_version number
    object_type string
    workflow_definition_name string
    workflow_definitions list(object)
    additionalProperties String
    catalogMoid String
    classId String
    description String
    Description of the health check definition.
    inputParameters String
    label String
    Label for the health check definition that is displayed on UI.
    name String
    Name of the health check definition.
    nrVersion Double
    objectType String
    workflowDefinitionName String
    workflowDefinitions List<GetWorkflowServiceItemHealthCheckDefinitionResultHealthCheckWorkflowWorkflowDefinition>
    additionalProperties string
    catalogMoid string
    classId string
    description string
    Description of the health check definition.
    inputParameters string
    label string
    Label for the health check definition that is displayed on UI.
    name string
    Name of the health check definition.
    nrVersion number
    objectType string
    workflowDefinitionName string
    workflowDefinitions GetWorkflowServiceItemHealthCheckDefinitionResultHealthCheckWorkflowWorkflowDefinition[]
    additional_properties str
    catalog_moid str
    class_id str
    description str
    Description of the health check definition.
    input_parameters str
    label str
    Label for the health check definition that is displayed on UI.
    name str
    Name of the health check definition.
    nr_version float
    object_type str
    workflow_definition_name str
    workflow_definitions Sequence[GetWorkflowServiceItemHealthCheckDefinitionResultHealthCheckWorkflowWorkflowDefinition]
    additionalProperties String
    catalogMoid String
    classId String
    description String
    Description of the health check definition.
    inputParameters String
    label String
    Label for the health check definition that is displayed on UI.
    name String
    Name of the health check definition.
    nrVersion Number
    objectType String
    workflowDefinitionName String
    workflowDefinitions List<Property Map>

    GetWorkflowServiceItemHealthCheckDefinitionResultHealthCheckWorkflowWorkflowDefinition

    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    additional_properties string
    class_id string
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    selector string
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String
    additionalProperties string
    classId string
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    selector string
    additional_properties str
    class_id str
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    selector str
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String

    GetWorkflowServiceItemHealthCheckDefinitionResultParent

    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    additional_properties string
    class_id string
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    selector string
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String
    additionalProperties string
    classId string
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    selector string
    additional_properties str
    class_id str
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    selector str
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String

    GetWorkflowServiceItemHealthCheckDefinitionResultPermissionResource

    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    additional_properties string
    class_id string
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    selector string
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String
    additionalProperties string
    classId string
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    selector string
    additional_properties str
    class_id str
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    selector str
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String

    GetWorkflowServiceItemHealthCheckDefinitionResultServiceItemDefinition

    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    additional_properties string
    class_id string
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    selector string
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String
    additionalProperties string
    classId string
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    selector string
    additional_properties str
    class_id str
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    selector str
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String

    GetWorkflowServiceItemHealthCheckDefinitionResultTag

    GetWorkflowServiceItemHealthCheckDefinitionResultTagAncestorDefinition

    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    additional_properties string
    class_id string
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    selector string
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String
    additionalProperties string
    classId string
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    selector string
    additional_properties str
    class_id str
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    selector str
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String

    GetWorkflowServiceItemHealthCheckDefinitionResultTagDefinition

    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    additional_properties string
    class_id string
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    selector string
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String
    additionalProperties string
    classId string
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    selector string
    additional_properties str
    class_id str
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    selector str
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String

    GetWorkflowServiceItemHealthCheckDefinitionResultVersionContext

    GetWorkflowServiceItemHealthCheckDefinitionResultVersionContextInterestedMo

    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    additional_properties string
    class_id string
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    selector string
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String
    additionalProperties string
    classId string
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    selector string
    additional_properties str
    class_id str
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    selector str
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String

    GetWorkflowServiceItemHealthCheckDefinitionResultVersionContextRefMo

    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    AdditionalProperties string
    ClassId string
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    Selector string
    additional_properties string
    class_id string
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    selector string
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String
    additionalProperties string
    classId string
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    selector string
    additional_properties str
    class_id str
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    selector str
    additionalProperties String
    classId String
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    selector String

    GetWorkflowServiceItemHealthCheckDefinitionServiceItemDefinition

    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties string
    class_id string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties string
    classId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties str
    class_id str
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    The fully-qualified name of the remote type referred by this relationship.
    selector str
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.

    GetWorkflowServiceItemHealthCheckDefinitionTag

    AdditionalProperties string
    AncestorDefinitions List<GetWorkflowServiceItemHealthCheckDefinitionTagAncestorDefinition>
    Definition GetWorkflowServiceItemHealthCheckDefinitionTagDefinition
    The definition is a reference to the tag definition object. The tag definition object contains the properties of the tag such as name, type, and description.
    Key string
    The string representation of a tag key.
    Propagated bool
    Propagated is a boolean flag that indicates whether the tag is propagated to the related managed objects.
    SysTag bool
    Specifies whether the tag is user-defined or owned by the system.
    Type string
    An enum type that defines the type of tag. Supported values are 'pathtag' and 'keyvalue'.

    • KeyValue - KeyValue type of tag. Key is required for these tags. Value is optional.
    • PathTag - Key contain path information. Value is not present for these tags. The path is created by using the '/' character as a delimiter.For example, if the tag is "A/B/C", then "A" is the parent tag, "B" is the child tag of "A" and "C" is the child tag of "B".
    Value string
    The string representation of a tag value.
    AdditionalProperties string
    AncestorDefinitions []GetWorkflowServiceItemHealthCheckDefinitionTagAncestorDefinition
    Definition GetWorkflowServiceItemHealthCheckDefinitionTagDefinition
    The definition is a reference to the tag definition object. The tag definition object contains the properties of the tag such as name, type, and description.
    Key string
    The string representation of a tag key.
    Propagated bool
    Propagated is a boolean flag that indicates whether the tag is propagated to the related managed objects.
    SysTag bool
    Specifies whether the tag is user-defined or owned by the system.
    Type string
    An enum type that defines the type of tag. Supported values are 'pathtag' and 'keyvalue'.

    • KeyValue - KeyValue type of tag. Key is required for these tags. Value is optional.
    • PathTag - Key contain path information. Value is not present for these tags. The path is created by using the '/' character as a delimiter.For example, if the tag is "A/B/C", then "A" is the parent tag, "B" is the child tag of "A" and "C" is the child tag of "B".
    Value string
    The string representation of a tag value.
    additional_properties string
    ancestor_definitions list(object)
    definition object
    The definition is a reference to the tag definition object. The tag definition object contains the properties of the tag such as name, type, and description.
    key string
    The string representation of a tag key.
    propagated bool
    Propagated is a boolean flag that indicates whether the tag is propagated to the related managed objects.
    sys_tag bool
    Specifies whether the tag is user-defined or owned by the system.
    type string
    An enum type that defines the type of tag. Supported values are 'pathtag' and 'keyvalue'.

    • KeyValue - KeyValue type of tag. Key is required for these tags. Value is optional.
    • PathTag - Key contain path information. Value is not present for these tags. The path is created by using the '/' character as a delimiter.For example, if the tag is "A/B/C", then "A" is the parent tag, "B" is the child tag of "A" and "C" is the child tag of "B".
    value string
    The string representation of a tag value.
    additionalProperties String
    ancestorDefinitions List<GetWorkflowServiceItemHealthCheckDefinitionTagAncestorDefinition>
    definition GetWorkflowServiceItemHealthCheckDefinitionTagDefinition
    The definition is a reference to the tag definition object. The tag definition object contains the properties of the tag such as name, type, and description.
    key String
    The string representation of a tag key.
    propagated Boolean
    Propagated is a boolean flag that indicates whether the tag is propagated to the related managed objects.
    sysTag Boolean
    Specifies whether the tag is user-defined or owned by the system.
    type String
    An enum type that defines the type of tag. Supported values are 'pathtag' and 'keyvalue'.

    • KeyValue - KeyValue type of tag. Key is required for these tags. Value is optional.
    • PathTag - Key contain path information. Value is not present for these tags. The path is created by using the '/' character as a delimiter.For example, if the tag is "A/B/C", then "A" is the parent tag, "B" is the child tag of "A" and "C" is the child tag of "B".
    value String
    The string representation of a tag value.
    additionalProperties string
    ancestorDefinitions GetWorkflowServiceItemHealthCheckDefinitionTagAncestorDefinition[]
    definition GetWorkflowServiceItemHealthCheckDefinitionTagDefinition
    The definition is a reference to the tag definition object. The tag definition object contains the properties of the tag such as name, type, and description.
    key string
    The string representation of a tag key.
    propagated boolean
    Propagated is a boolean flag that indicates whether the tag is propagated to the related managed objects.
    sysTag boolean
    Specifies whether the tag is user-defined or owned by the system.
    type string
    An enum type that defines the type of tag. Supported values are 'pathtag' and 'keyvalue'.

    • KeyValue - KeyValue type of tag. Key is required for these tags. Value is optional.
    • PathTag - Key contain path information. Value is not present for these tags. The path is created by using the '/' character as a delimiter.For example, if the tag is "A/B/C", then "A" is the parent tag, "B" is the child tag of "A" and "C" is the child tag of "B".
    value string
    The string representation of a tag value.
    additional_properties str
    ancestor_definitions Sequence[GetWorkflowServiceItemHealthCheckDefinitionTagAncestorDefinition]
    definition GetWorkflowServiceItemHealthCheckDefinitionTagDefinition
    The definition is a reference to the tag definition object. The tag definition object contains the properties of the tag such as name, type, and description.
    key str
    The string representation of a tag key.
    propagated bool
    Propagated is a boolean flag that indicates whether the tag is propagated to the related managed objects.
    sys_tag bool
    Specifies whether the tag is user-defined or owned by the system.
    type str
    An enum type that defines the type of tag. Supported values are 'pathtag' and 'keyvalue'.

    • KeyValue - KeyValue type of tag. Key is required for these tags. Value is optional.
    • PathTag - Key contain path information. Value is not present for these tags. The path is created by using the '/' character as a delimiter.For example, if the tag is "A/B/C", then "A" is the parent tag, "B" is the child tag of "A" and "C" is the child tag of "B".
    value str
    The string representation of a tag value.
    additionalProperties String
    ancestorDefinitions List<Property Map>
    definition Property Map
    The definition is a reference to the tag definition object. The tag definition object contains the properties of the tag such as name, type, and description.
    key String
    The string representation of a tag key.
    propagated Boolean
    Propagated is a boolean flag that indicates whether the tag is propagated to the related managed objects.
    sysTag Boolean
    Specifies whether the tag is user-defined or owned by the system.
    type String
    An enum type that defines the type of tag. Supported values are 'pathtag' and 'keyvalue'.

    • KeyValue - KeyValue type of tag. Key is required for these tags. Value is optional.
    • PathTag - Key contain path information. Value is not present for these tags. The path is created by using the '/' character as a delimiter.For example, if the tag is "A/B/C", then "A" is the parent tag, "B" is the child tag of "A" and "C" is the child tag of "B".
    value String
    The string representation of a tag value.

    GetWorkflowServiceItemHealthCheckDefinitionTagAncestorDefinition

    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties string
    class_id string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties string
    classId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties str
    class_id str
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    The fully-qualified name of the remote type referred by this relationship.
    selector str
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.

    GetWorkflowServiceItemHealthCheckDefinitionTagDefinition

    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties string
    class_id string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties string
    classId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties str
    class_id str
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    The fully-qualified name of the remote type referred by this relationship.
    selector str
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.

    GetWorkflowServiceItemHealthCheckDefinitionVersionContext

    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    InterestedMos List<GetWorkflowServiceItemHealthCheckDefinitionVersionContextInterestedMo>
    MarkedForDeletion bool
    The flag to indicate if snapshot is marked for deletion or not. If flag is set then snapshot will be removed after the successful deployment of the policy.
    NrVersion string
    The version of the Managed Object, e.g. an incrementing number or a hash id.
    ObjectType string
    The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
    RefMo GetWorkflowServiceItemHealthCheckDefinitionVersionContextRefMo
    A reference to the original Managed Object.
    Timestamp string
    The time this versioned Managed Object was created.
    VersionType string
    Specifies type of version. Currently the only supported value is "Configured" that is used to keep track of snapshots of policies and profiles that are intended to be configured to target endpoints.

    • Modified - Version created every time an object is modified.
    • Configured - Version created every time an object is configured to the service profile.
    • Deployed - Version created for objects related to a service profile when it is deployed.
    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    InterestedMos []GetWorkflowServiceItemHealthCheckDefinitionVersionContextInterestedMo
    MarkedForDeletion bool
    The flag to indicate if snapshot is marked for deletion or not. If flag is set then snapshot will be removed after the successful deployment of the policy.
    NrVersion string
    The version of the Managed Object, e.g. an incrementing number or a hash id.
    ObjectType string
    The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
    RefMo GetWorkflowServiceItemHealthCheckDefinitionVersionContextRefMo
    A reference to the original Managed Object.
    Timestamp string
    The time this versioned Managed Object was created.
    VersionType string
    Specifies type of version. Currently the only supported value is "Configured" that is used to keep track of snapshots of policies and profiles that are intended to be configured to target endpoints.

    • Modified - Version created every time an object is modified.
    • Configured - Version created every time an object is configured to the service profile.
    • Deployed - Version created for objects related to a service profile when it is deployed.
    additional_properties string
    class_id string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    interested_mos list(object)
    marked_for_deletion bool
    The flag to indicate if snapshot is marked for deletion or not. If flag is set then snapshot will be removed after the successful deployment of the policy.
    nr_version string
    The version of the Managed Object, e.g. an incrementing number or a hash id.
    object_type string
    The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
    ref_mo object
    A reference to the original Managed Object.
    timestamp string
    The time this versioned Managed Object was created.
    version_type string
    Specifies type of version. Currently the only supported value is "Configured" that is used to keep track of snapshots of policies and profiles that are intended to be configured to target endpoints.

    • Modified - Version created every time an object is modified.
    • Configured - Version created every time an object is configured to the service profile.
    • Deployed - Version created for objects related to a service profile when it is deployed.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    interestedMos List<GetWorkflowServiceItemHealthCheckDefinitionVersionContextInterestedMo>
    markedForDeletion Boolean
    The flag to indicate if snapshot is marked for deletion or not. If flag is set then snapshot will be removed after the successful deployment of the policy.
    nrVersion String
    The version of the Managed Object, e.g. an incrementing number or a hash id.
    objectType String
    The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
    refMo GetWorkflowServiceItemHealthCheckDefinitionVersionContextRefMo
    A reference to the original Managed Object.
    timestamp String
    The time this versioned Managed Object was created.
    versionType String
    Specifies type of version. Currently the only supported value is "Configured" that is used to keep track of snapshots of policies and profiles that are intended to be configured to target endpoints.

    • Modified - Version created every time an object is modified.
    • Configured - Version created every time an object is configured to the service profile.
    • Deployed - Version created for objects related to a service profile when it is deployed.
    additionalProperties string
    classId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    interestedMos GetWorkflowServiceItemHealthCheckDefinitionVersionContextInterestedMo[]
    markedForDeletion boolean
    The flag to indicate if snapshot is marked for deletion or not. If flag is set then snapshot will be removed after the successful deployment of the policy.
    nrVersion string
    The version of the Managed Object, e.g. an incrementing number or a hash id.
    objectType string
    The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
    refMo GetWorkflowServiceItemHealthCheckDefinitionVersionContextRefMo
    A reference to the original Managed Object.
    timestamp string
    The time this versioned Managed Object was created.
    versionType string
    Specifies type of version. Currently the only supported value is "Configured" that is used to keep track of snapshots of policies and profiles that are intended to be configured to target endpoints.

    • Modified - Version created every time an object is modified.
    • Configured - Version created every time an object is configured to the service profile.
    • Deployed - Version created for objects related to a service profile when it is deployed.
    additional_properties str
    class_id str
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    interested_mos Sequence[GetWorkflowServiceItemHealthCheckDefinitionVersionContextInterestedMo]
    marked_for_deletion bool
    The flag to indicate if snapshot is marked for deletion or not. If flag is set then snapshot will be removed after the successful deployment of the policy.
    nr_version str
    The version of the Managed Object, e.g. an incrementing number or a hash id.
    object_type str
    The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
    ref_mo GetWorkflowServiceItemHealthCheckDefinitionVersionContextRefMo
    A reference to the original Managed Object.
    timestamp str
    The time this versioned Managed Object was created.
    version_type str
    Specifies type of version. Currently the only supported value is "Configured" that is used to keep track of snapshots of policies and profiles that are intended to be configured to target endpoints.

    • Modified - Version created every time an object is modified.
    • Configured - Version created every time an object is configured to the service profile.
    • Deployed - Version created for objects related to a service profile when it is deployed.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    interestedMos List<Property Map>
    markedForDeletion Boolean
    The flag to indicate if snapshot is marked for deletion or not. If flag is set then snapshot will be removed after the successful deployment of the policy.
    nrVersion String
    The version of the Managed Object, e.g. an incrementing number or a hash id.
    objectType String
    The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
    refMo Property Map
    A reference to the original Managed Object.
    timestamp String
    The time this versioned Managed Object was created.
    versionType String
    Specifies type of version. Currently the only supported value is "Configured" that is used to keep track of snapshots of policies and profiles that are intended to be configured to target endpoints.

    • Modified - Version created every time an object is modified.
    • Configured - Version created every time an object is configured to the service profile.
    • Deployed - Version created for objects related to a service profile when it is deployed.

    GetWorkflowServiceItemHealthCheckDefinitionVersionContextInterestedMo

    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties string
    class_id string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties string
    classId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties str
    class_id str
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    The fully-qualified name of the remote type referred by this relationship.
    selector str
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.

    GetWorkflowServiceItemHealthCheckDefinitionVersionContextRefMo

    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    AdditionalProperties string
    ClassId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    Moid string
    The unique identifier of this Managed Object instance.
    ObjectType string
    The fully-qualified name of the remote type referred by this relationship.
    Selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties string
    class_id string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    object_type string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties string
    classId string
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid string
    The unique identifier of this Managed Object instance.
    objectType string
    The fully-qualified name of the remote type referred by this relationship.
    selector string
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additional_properties str
    class_id str
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid str
    The unique identifier of this Managed Object instance.
    object_type str
    The fully-qualified name of the remote type referred by this relationship.
    selector str
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
    additionalProperties String
    classId String
    The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
    moid String
    The unique identifier of this Managed Object instance.
    objectType String
    The fully-qualified name of the remote type referred by this relationship.
    selector String
    An OData $filter expression which describes the REST resource to be referenced. This field may be set instead of 'moid' by clients.

    1. If 'moid' is set this field is ignored.
    2. If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.

    Package Details

    Repository
    intersight ciscodevnet/terraform-provider-intersight
    License
    Notes
    This Pulumi package is based on the intersight Terraform Provider.
    Viewing docs for intersight 1.0.78
    published on Tuesday, Apr 21, 2026 by ciscodevnet

      Try Pulumi Cloud free.
      Your team will thank you.

      Start free trial